PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000197283
Common NameMYB36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 352aa    MW: 40398.2 Da    PI: 6.4339
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000197283genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W+t ++  g+ R++k+c++r  +yl
    MDP0000197283 14 KGPWTPEEDQKLMDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRXTNYL 61
                     79*****************************************99996 PP

2Myb_DNA-binding52.21.4e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
    MDP0000197283  67 RGXFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.196961IPR017930Myb domain
SuperFamilySSF466895.62E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-101363IPR001005SANT/Myb domain
PfamPF002491.9E-141461IPR001005SANT/Myb domain
CDDcd001671.26E-91661No hitNo description
PROSITE profilePS5129424.89862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2565116IPR009057Homeodomain-like
SMARTSM007174.7E-1666114IPR001005SANT/Myb domain
PfamPF002493.0E-1567111IPR001005SANT/Myb domain
CDDcd001679.54E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLMDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRXTNY  60
LRPDIKRGXF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDFSSILY NSSHHHHQMN NFSRLLGQPI GLNPELLRLA TSLIQSRXEN  180
NSNQNFVLQN AQENDYHQIC NPQIQPQQPV QDNVPYPNEV SQLMQQQPNV EYPSSLSDFR  240
SQNSQLNEWQ SNVGTSNFTE EYVELPSFAY FGSEQHQTXL DLSPEXSNFH SNNSNQNFSF  300
TSVXSTPSSS PTTLNSNSTT YFNSGTEDER ESYCSNMLKF GIPDILGVNE FM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.30080.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5076711e-134AY507671.1 Malus x domestica putative MYB transcription factor (MYB) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281023.10.0protein ODORANT1-like
TrEMBLD9ZJ640.0D9ZJ64_MALDO; MYB domain class transcription factor
STRINGGLYMA15G07230.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-110MYB-like 102